PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 300aa    MW: 34446.6 Da    PI: 5.3557
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00430genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEde+l ++++++G g+W++ +++ g++R++k+c++rw +yl
       AA40G00430 14 KGPWTIEEDEKLMKYIQEHGHGSWRALPKEAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.37.3e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++ +lG++ W++Ia+ ++ gRt++++k++w+++l
       AA40G00430  67 RGNFTKEEEDTIINLHSLLGNK-WSSIASNLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.536961IPR017930Myb domain
SuperFamilySSF466894.77E-3211108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002497.8E-171461IPR001005SANT/Myb domain
CDDcd001674.68E-101661No hitNo description
PROSITE profilePS5129427.49962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2765116IPR009057Homeodomain-like
SMARTSM007172.7E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1667112IPR001005SANT/Myb domain
CDDcd001679.83E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MVRLPCCDET GLKKGPWTIE EDEKLMKYIQ EHGHGSWRAL PKEAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TKEEEDTIIN LHSLLGNKWS SIASNLPGRT DNEIKNYWNT HLKKKLLQMG  120
IDPITHRPRT DHLNVLNALP QLIAAANFNN LLNLNQFDAT TLAKTQLVHN MIQILTTNNN  180
TNPNFGQSLF LENQNLFDQS QNFSQILDNH LDTTNSLAIG IDDQISLPPL ISDFCDETKE  240
SEMMIKNKNS NPSSSLSIST HDDDHHQPWC EMIDDETSDS YWKDIIEQTC PETWPFSDKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-28121162105C-Myb DNA-Binding Domain
1mse_C1e-28121162105C-Myb DNA-Binding Domain
1a5j_A2e-28121165108B-MYB
1gv2_A2e-28121162105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197179.21e-153myb domain protein 9
RefseqNP_974792.11e-153myb domain protein 9
SwissprotQ8GWP06e-78MYB39_ARATH; Transcription factor MYB39
TrEMBLF4KE691e-152F4KE69_ARATH; Myb domain protein 9
STRINGAT5G16770.11e-152(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-139myb domain protein 9